PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0393s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 249aa    MW: 25619.6 Da    PI: 8.2798
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0393s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1222e-383292262
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            ++++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rkn k+s
  SapurV1A.0393s0060.1.p 32 EQEHLPCPRCDSTNTKFCYYNNYNYSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKNAKRS 92
                            68899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-292990IPR003851Zinc finger, Dof-type
PfamPF027015.1E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2083690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MPAELTPCEA TRRPQQSTPA TLTKAGGAPP QEQEHLPCPR CDSTNTKFCY YNNYNYSQPR  60
HFCKSCRRYW THGGTLRDIP VGGGTRKNAK RSRTSATSPV SFVGPLTGTS IDNLPLPATP  120
VLLPLSANQG LSVHYGGGDG KGNGGGLGGS FTSLLNTQGP AGFLALNGFG IGLGSGIEDV  180
NFALGRGLWP FPGMGDVGAS VGGNGGAAVT AGLGNTWQFE NGQENGFVGG DCFSWPDLAI  240
STPGNGLK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2128450.0AC212845.1 Populus trichocarpa clone POP021-P21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039246.11e-157PREDICTED: LOW QUALITY PROTEIN: dof zinc finger protein DOF3.4
SwissprotQ390882e-66DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLB9HEE81e-156B9HEE8_POPTR; DNA binding with one finger 5 family protein
STRINGPOPTR_0007s11790.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.15e-54OBF binding protein 1